LL-37 · Pep IQ

Origin & Background

Your body's first line of defence

LL-37 is the only human cathelicidin — a 37-amino acid peptide produced by the proteolytic cleavage of its precursor protein hCAP-18 (Human Cationic Antimicrobial Protein of 18 kDa). It is named for its two N-terminal leucine residues and its 37-amino acid length. Its full sequence is [LL-37, 37 aa]

The peptide is produced by neutrophils, epithelial cells of the skin, lungs, gut, and urogenital tract, and mast cells. It is released at sites of infection and inflammation to provide immediate, broad-spectrum antimicrobial protection before the adaptive immune system can respond. Every time you get a skin wound, your epithelial cells immediately upregulate LL-37 production — levels peak at 48 hours post-injury and decline as the wound closes.

The clinical significance of LL-37 became apparent when researchers found that chronic wounds (diabetic ulcers, pressure sores, non-healing surgical wounds) have dramatically lower LL-37 levels than healing wounds. The absence of LL-37 at the ulcer edge in chronic wounds is now understood as both a biomarker and a potential driver of impaired healing. Replenishing LL-37 at wound sites has become an active therapeutic target.

Note on sourcing: Exogenous LL-37 is available as a research peptide. It is not FDA-approved for therapeutic use. Most current research focuses on topical application to wounds and skin infections, and intranasal delivery for respiratory infections. Injectable systemic use carries cytotoxicity risks at higher concentrations and is not well-characterised in humans at therapeutic doses.

Science & Mechanism

Membrane disruption, immune modulation, and wound healing

Mechanism of Action

Direct membrane disruption: LL-37 is cationic (positively charged) and amphipathic. Bacterial membranes are negatively charged, creating electrostatic attraction. LL-37 inserts into bacterial membranes and disrupts their integrity through a carpet model — covering the surface and creating holes, causing bacterial death. This mechanism is fundamentally different from conventional antibiotics and does not readily generate resistance.

Anti-biofilm activity: LL-37 is particularly effective against bacterial biofilms — the protective matrix that makes chronic wound infections antibiotic-resistant. It disrupts pre-formed biofilms of Pseudomonas aeruginosa and Staphylococcus aureus (including MRSA) at concentrations that have minimal effect on host cells. This anti-biofilm property is one of its most clinically compelling features.

Broad-spectrum antimicrobial activity: Gram-positive bacteria (Staph aureus, Strep), Gram-negative bacteria (Pseudomonas, E. coli, Klebsiella), fungi, HSV-1, adenovirus, HIV, and parasites. Corneal epithelial cells expressing LL-37 showed significant reduction in HSV-1 and adenovirus 19 titres. This antiviral activity operates through direct viral envelope disruption and prevention of host cell entry.

Re-epithelialization and wound healing: LL-37 is not just antimicrobial — it is a wound healing signal. It stimulates keratinocyte migration, proliferation, and differentiation via EGF receptor transactivation. It promotes angiogenesis (new blood vessel formation essential for healing). In chronic ulcers, where LL-37 is absent from the wound edge, adding LL-37 restores epithelial cell proliferation markers including Ki67.

Immune modulation: LL-37 acts as a chemoattractant for neutrophils, monocytes, and mast cells. It activates dendritic cell maturation. It modulates TLR4 and TLR9 signalling — amplifying immune responses to infection while also suppressing excessive inflammatory damage through LPS neutralisation. At higher concentrations it can paradoxically promote inflammation; at physiological concentrations it is broadly immunomodulatory.

Keratinocyte protection from apoptosis: LL-37 upregulates COX-2 expression in keratinocytes, protecting skin cells from apoptosis during infection and injury. This anti-apoptotic effect on skin cells complements its direct antimicrobial action to preserve the skin barrier.

The scope of LL-37's activity goes far beyond simple antimicrobial killing. It is now understood as a master regulator of the innate immune response at barrier tissues — orchestrating the recruitment, activation, and coordination of the early immune response while directly killing pathogens and facilitating tissue repair simultaneously. No conventional antibiotic does more than one of these things.

Benefits & Evidence

What the data shows

🦠

Broad-spectrum antimicrobial — direct killing

In vitro: kills Pseudomonas aeruginosa (EC50 ~2-4 μg/ml), S. aureus (EC50 ~1.6 μg/ml), S. epidermidis, MRSA, E. coli, HSV-1, adenovirus 19. Effective against multidrug-resistant organisms. Anti-biofilm activity at sub-bactericidal concentrations disrupts preformed MRSA and Pseudomonas biofilms.

● Strong — well-characterised in vitro + animal models

🩹

Wound healing and re-epithelialization

hCAP18 levels peak at 48h post-wounding and track with healing progress. Absent in chronic ulcer epithelium — restoration correlates with Ki67 (cell proliferation) restoration. Stimulates keratinocyte migration via EGF receptor. Promotes angiogenesis. Recombinant LL-37 accelerates wound closure in ex vivo models.

● Moderate — ex vivo human + animal data

🛡️

Innate immune modulation

Recruits neutrophils, monocytes, mast cells. Activates dendritic cell maturation. Neutralises LPS (bacterial endotoxin) to prevent septic shock response. Modulates TLR signalling. The Springer (2025) study confirmed antimicrobial activity against 43 clinical bacterial strains from urogenital, GI, eye, and wound infections.

● Moderate — multiple human cell + in vivo studies

👁️

Ocular and mucosal protection

Corneal and conjunctival epithelia naturally express LL-37 as part of ocular innate immunity. Active against HSV-1 and adenovirus in ocular models. Expressed in respiratory, GI, and urogenital mucosa — present wherever the body meets the outside world.

● Moderate — tissue expression studies + in vitro

Things to know

Risks & considerations

Concentration-dependent cytotoxicity is the key safety concern. At antimicrobial concentrations, LL-37 can damage host cell membranes as well as bacterial ones. The therapeutic window is real but requires careful dosing. Topical application with local concentrations is lower risk than systemic injection. The 2025 PMC review notes that clinical application is limited by cytotoxicity, proteolytic instability, and production costs — not by fundamental safety concerns at appropriate doses.

Moderate

Concentration-dependent cytotoxicity — at higher concentrations LL-37 disrupts host cell membranes in addition to bacterial membranes. The therapeutic window for systemic use is narrower than for topical use. Established in cell culture; less characterised in vivo humans.

Mild

Proteolytic instability — native LL-37 is rapidly degraded by proteases in wound fluid, serum, and tissue. Effective topical concentrations require higher doses to maintain activity at the target site. Modified analogues with greater stability are in development.

Moderate

Pro-inflammatory at high doses — at concentrations above physiological, LL-37 can amplify inflammatory responses rather than modulate them. Paradoxically, excess LL-37 is found in psoriasis lesions and contributes to the psoriatic inflammatory cascade.

Unknown

Systemic injection safety not established — topical and intranasal use has the most safety justification. Injectable systemic LL-37 has limited human safety data. Not recommended outside of clinical trial settings.

⚠ Key Warnings

LL-37 is not FDA-approved for any indication. All available material is from research chemical suppliers with variable quality control.

Topical application to wounds has the best safety justification. Systemic injection is not recommended outside clinical trial settings.

Elevated LL-37 is found in psoriasis — people with psoriasis or other inflammatory skin conditions should exercise particular caution.

The most promising clinical development direction is novel analogues with improved stability and reduced cytotoxicity — not native LL-37 itself. The next generation of cathelicidin therapeutics will likely be modified analogues.